From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

PG 99-465   Click here for help

GtoPdb Ligand ID: 2272

Synonyms: Myr-His1[Lys12,Lys27,28,Gly29,30,Thr31]VIP | PG99-465
Compound class: Peptide
Click here for help
Peptide Sequence Click here for help
HSDAVFTDNYTKLRKQMAVKKYLNSIKKGGT
Myr-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Lys-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Lys-Lys-Gly-Gly-Thr
Chemical Modification
N-terminal residue is myristoyl-histidine