From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

α-bungarotoxin   Click here for help

GtoPdb Ligand ID: 3964

Compound class: Peptide
Comment: From Bungarus multicinctus (Many-banded krait)
Peptide Sequence Click here for help
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Ile-Val-Cys-His-Thr-Thr-Ala-Thr-Ser-Pro-Ile-Ser-Ala-Val-Thr-Cys-Pro-Pro-Gly-Gly-Asn-Leu-Cys-Tyr-Arg-Lys-Met-Trp-Cys-Asp-Ala-Phe-Cys-Ser-Ser-Arg-Gly-Lys-Val-Val-Glu-Leu-Gly-Cys-Ala-Ala-Thr-Cys-Pro-Ser-Lys-Lys-Pro-Tyr-Glu-Glu-Val-Thr-Cys-Cys-Ser-Thr-Asp-Lys-Cys-Asn-Pro-His-Pro-Lys-Gln-Arg-Pro-Gly
Post-translational Modification
Disulfide bridges between amino acids 3 - 23, 16 - 44, 29 - 33, 48 - 59, 60 - 65