GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IFN-α8   Click here for help

GtoPdb Ligand ID: 4966

Synonyms: IFN-alpha-8 | interferon alpha-8 | interferon alpha-B | interferon alpha-B2
Immunopharmacology Ligand
Compound class: Endogenous peptide in human, mouse or rat
Comment: IFN-α8 is a type I IFN.
Species: Human
Peptide Sequence Click here for help
CDLPQTHSLGNRRALILLAQMRRISPFSCLKDRHDFEFPQEEFDDKQFQKAQAISVLHEMIQQTFNLFSTKDSSAALDET
LLDEFYIELDQQLNDLESCVMQEVGVIESPLMYEDSILAVRKYFQRITLYLTEKKYSSCAWEVVRAEIMRSFSLSINLQK
RLKSKE
Post-translational Modification
Predicted disulphide bond formation between cysteine residues at positions 1 and 99, and 29 and 139