GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

thymic stromal lymphopoietin   Click here for help

GtoPdb Ligand ID: 5083

Abbreviated name: TSLP
Immunopharmacology Ligand
Compound class: Endogenous peptide in human, mouse or rat
Comment: Thymic stromal lymphopoietin (TLSP), an IL-7 like cytokine, is the endogenous ligand for the TLSP receptor. TLSP/TLSPR signalling is pro-inflammatory.
Species: Human
Peptide Sequence Click here for help
YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAI
WCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Post-translational Modification
Predicted N-linked glycosylation of asparagine residues at positions 36 and 91