From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

Rho GDP dissociation inhibitor beta   Click here for help

GtoPdb Ligand ID: 5174

Abbreviated name: D4-GDI
Synonyms: Rho GDP-dissociation inhibitor 2 | Rho-GDI 2 | Rho-GDI beta
Compound class: Endogenous peptide in human, mouse or rat
Species: Human
Peptide Sequence Click here for help
TEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPG
PITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEE
APKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE
Post-translational Modification
Lysine residues at positions 20, 24, 40, 46, 101, 123, 144, 174 are N6-acetyllysine; N-terminal residue is N-acetylthreonine; serine residue at position 145 is phosphoserine