GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IL-36α   Click here for help

GtoPdb Ligand ID: 5881

Synonyms: FIL1 epsilon | interleukin-1 epsilon (IL-1 epsilon)
Immunopharmacology Ligand
Compound class: Endogenous peptide in human, mouse or rat
Comment: IL-36α, IL-36β, IL-36γ, and IL-36 receptor antagonist form the IL-36 group of cytokines and are a subset of the IL-1 cytokine family. IL-36α, IL-36β, IL-36γ are agonists of the IL-36 receptor complex (IL1RL2/IL1R-rp2/IL-36 receptor) and activate NF-κB and MAP kinase pathways inducing a pro-inflammatory response. The IL-36 receptor antagonist as its name suggests antagonises signalling by the IL-36 receptor agonists to reduce their pro-inflammatory function.
Species: Human
Peptide Sequence Click here for help
MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVG
DQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
Met-Glu-Lys-Ala-Leu-Lys-Ile-Asp-Thr-Pro-Gln-Gln-Gly-Ser-Ile-Gln-Asp-Ile-Asn-His-Arg-Val-Trp-Val-Leu-Gln-Asp-Gln-Thr-Leu-Ile-Ala-Val-Pro-Arg-Lys-Asp-Arg-Met-Ser-Pro-Val-Thr-Ile-Ala-Leu-Ile-Ser-Cys-Arg-His-Val-Glu-Thr-Leu-Glu-Lys-Asp-Arg-Gly-Asn-Pro-Ile-Tyr-Leu-Gly-Leu-Asn-Gly-Leu-Asn-Leu-Cys-Leu-Met-Cys-Ala-Lys-Val-Gly-Asp-Gln-Pro-Thr-Leu-Gln-Leu-Lys-Glu-Lys-Asp-Ile-Met-Asp-Leu-Tyr-Asn-Gln-Pro-Glu-Pro-Val-Lys-Ser-Phe-Leu-Phe-Tyr-His-Ser-Gln-Ser-Gly-Arg-Asn-Ser-Thr-Phe-Glu-Ser-Val-Ala-Phe-Pro-Gly-Trp-Phe-Ile-Ala-Val-Ser-Ser-Glu-Gly-Gly-Cys-Pro-Leu-Ile-Leu-Thr-Gln-Glu-Leu-Gly-Lys-Ala-Asn-Thr-Thr-Asp-Phe-Gly-Leu-Thr-Met-Leu-Phe
Post-translational Modification
Tyrosine residue at position 96 is nitrated.