GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

galectin-1   Click here for help

GtoPdb Ligand ID: 6603

Synonyms: GBP
Immunopharmacology Ligand
Compound class: Endogenous peptide in human, mouse or rat
Comment: Gal-1 is a mammalian lectin that is active in the immune system. Its participation in the induction of self-tolerance suggests that any altered activity could lead to a failure to select out autoreactive cells, which may be relevant to autoimmune disease pathogenesis.
Species: Human
Peptide Sequence Click here for help
GLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWGTEQREAVFPFQPG
SVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIKCVAFD