From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

pramlintide   Click here for help

GtoPdb Ligand ID: 7482

Synonyms: AC0137 | Symlin®
Approved drug
pramlintide is an approved drug (FDA (2005))
Compound class: Peptide
Comment: Pramlintide is an analogue of human amylin, with prolines replacing the native amino acids at positions 25, 28 and 29. The marketed medicine is the acetate salt (PubChem CID 16132446). ChEMBL also represents the acetate form with the record CHEMBL1201669.
Click here for help
IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: pramlintide

Peptide Sequence Click here for help
KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY
Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr
Chemical Modification
Carboxy terminal amidated.