GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

CXCL12δ   Click here for help

GtoPdb Ligand ID: 8531

Immunopharmacology Ligand
Compound class: Endogenous peptide in human, mouse or rat
Comment: Protein product of a splice variant of the CXCL12 gene. Identification of CXCL12δ is reported in [1], and it is most highly expressed in fetal liver.
Species: Human
Peptide Sequence Click here for help
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNNLISAAPAGKRVI
AGARALHPSPPRACPTARALCEIRLWPPPEWSWPSPGDV
Lys-Pro-Val-Ser-Leu-Ser-Tyr-Arg-Cys-Pro-Cys-Arg-Phe-Phe-Glu-Ser-His-Val-Ala-Arg-Ala-Asn-Val-Lys-His-Leu-Lys-Ile-Leu-Asn-Thr-Pro-Asn-Cys-Ala-Leu-Gln-Ile-Val-Ala-Arg-Leu-Lys-Asn-Asn-Asn-Arg-Gln-Val-Cys-Ile-Asp-Pro-Lys-Leu-Lys-Trp-Ile-Gln-Glu-Tyr-Leu-Glu-Lys-Ala-Leu-Asn-Asn-Leu-Ile-Ser-Ala-Ala-Pro-Ala-Gly-Lys-Arg-Val-Ile-Ala-Gly-Ala-Arg-Ala-Leu-His-Pro-Ser-Pro-Pro-Arg-Ala-Cys-Pro-Thr-Ala-Arg-Ala-Leu-Cys-Glu-Ile-Arg-Leu-Trp-Pro-Pro-Pro-Glu-Trp-Ser-Trp-Pro-Ser-Pro-Gly-Asp-Val