From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

IL-34   Click here for help

GtoPdb Ligand ID: 8975

Immunopharmacology Ligand
Comment: IL-34 is an endogenous ligand of the receptor tyrosine kinase, colony stimulating factor 1 receptor (CSF1R) [3]. It is a homodimeric cytokine.
Species: Human
Peptide Sequence Click here for help
MPRGFTWLRYLGIFLGVALGNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVPYEGVFRIANVTRL
QRAQVSERELRYLWVLVSLSATESVQDVLLEGHPSWKYLQEVETLLLNVQQGLTDVEVSPKVESVLSLLNAPGPNLKLVR
PKALLDNCFRVMELLYCSCCKQSSVLNWQDCEVPSPQSCSPEPSLQYAATQLYPPPPWSPSSPPHSTGSVRPVRAQGEGL
LP
Post-translational Modification
1-20 is the signal peptide, 21-242 is the ligand sequence. N-linked glycosylation at position 76.