From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

brimapitide   Click here for help

GtoPdb Ligand ID: 9101

Synonyms: AM-111 | D-JNKI-1 | XG-102
Immunopharmacology Ligand
Compound class: Peptide
Comment: Brimapitide is a highly selective, non-competitive, long-acting inhibitor of c-jun N-terminal kinase (JNK). The peptide is an investigational drug for the intratympanic (i.t.) treatment of acute sensorineural hearing loss (ASNHL). Structurally the peptide consists of 20 amino acids from C-Jun-amino-terminal kinase-interacting protein 1 (JIP-1) fused to a carrier peptide derived from HIV-TAT48-57 (TAT) peptide PPRRRQRRKKRG. The peptide is constructed in a D-retro-inverso configuration to render it protease resistant. The TAT peptide mediates cell permeability. The sequence is claimed in patent US8080517 (SEQ ID NO: 11, D-JNKI1) [2]. The research codes XG-102 and AM-111 seem to be applied to this investigational agent.
Click here for help
Peptide Sequence Click here for help
DQSRPVQPFLNLTTPRKPRPPRRRQRRKKRG
Asp-Gln-Ser-Arg-Pro-Val-Gln-Pro-Phe-Leu-Asn-Leu-Thr-Thr-Pro-Arg-Lys-Pro-Arg-Pro-Pro-Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly
Chemical Modification
Modified residue: G (Gly) = glycinamide