From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.

urotensin 1 (fish)   Click here for help

GtoPdb Ligand ID: 922

Compound class: Peptide
Comment: Peptide isolated from the white sucker fish (Catostomus commersonii)
Click here for help
Peptide Sequence Click here for help
NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV
Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val