glucagon-like peptide 1-(7-36) amide   Click here for help

GtoPdb Ligand ID: 1132

Synonyms: GLP-1(7-36)amide
Compound class: Endogenous peptide in human, mouse or rat
Comment: The sequence is identical in human, rat and mouse.
Species: Human, Mouse, Rat
Click here for help

Ligand Activity Visualisation Charts

These are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts.

✖

View interactive charts of activity data across species
Peptide Sequence Click here for help
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
Post-translational Modification
The C-terminal arginine is amidated. GLP-1 (7-36) amide is a N-terminally truncated fragment of GLP1 [1,3]. GLP-1 (7-36) amide is the more predominant fragment of the precursor