From August 18th 2026, GtoPdb will require users to register to use the website. Please see our blog post for more information.
|
Synonyms: compound 1 [US9938335B2] | IBI-362 | IBI362 | LY-3305677 | LY3305677
mazdutide is an approved drug
Compound class:
Peptide
Comment: Mazdutide (IBI362 or LY3305677) is a dual glucagon-like peptide-1 and glucagon receptor agonist. It is an acylated long-acting synthetic single-chain peptide analogue of the mammalian intestinal hormone oxyntomodulin [5,7-8]. SMILES string was obtained from PubChem.
Ligand Activity Visualisation ChartsThese are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts. ✖ |
|
|||||||||||||||||
Peptide Sequence ![]() |
|
| HXQGTFTSDYSKYLDEKKAKEFVEWLLEGGPSSG | |
| Chemical Modification | |
| X, K20 and G34 residues are modified. | |
Download 2D Structure ![]() |
|
| Canonical SMILES | Download |
| Isomeric SMILES | Download |
| InChI standard identifier | Download |
| InChI standard key | Download |
Molecular structure representations generated using Open Babel