PHV

Ligand id: 2275

Name: PHV

Species: Rat

Peptide Sequence
HADGVFTSDYSRLLGQISAKKYLESLIGKRISSSISEDPVPV
His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Tyr-Ser-Arg-Leu-Leu-Gly-Gln-Ile-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Ile-Gly-Lys-Arg-Ile-Ser-Ser-Ser-Ile-Ser-Glu-Asp-Pro-Val-Pro-Val-NH2
Post-translational Modification
C-terminal residue is valine amide