jingzhaotoxin-III

Ligand id: 2574

Name: jingzhaotoxin-III

Peptide Sequence
DGECGGFWWKCGRGKPPCCKGYACSKTWGWCAVEAP
Asp-Gly-Glu-Cys-Gly-Gly-Phe-Trp-Trp-Lys-Cys-Gly-Arg-Gly-Lys-Pro-Pro-Cys-Cys-Lys-Gly-Tyr-Ala-Cys-Ser-Lys-Thr-Trp-Gly-Trp-Cys-Ala-Val-Glu-Ala-Pro
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 4 and 19, 11 and 24, and 18 and 31.