psalmotoxin 1

Ligand id: 4292

Name: psalmotoxin 1

Structure and Physico-chemical Properties

2D Structure
Peptide Sequence
EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT
Glu-Asp-Cys-Ile-Pro-Lys-Trp-Lys-Gly-Cys-Val-Asn-Arg-His-Gly-Asp-Cys-Cys-Glu-Gly-Leu-Glu-Cys-Trp-Lys-Arg-Arg-Arg-Ser-Phe-Glu-Val-Cys-Val-Pro-Lys-Thr-Pro-Lys-Thr-NH2
Download 2D Structure
Canonical SMILES Download
Isomeric SMILES Download
InChI standard identifier Download
InChI standard key Download

Molecular structure representations generated using Open Babel