Abbreviated name: GDF7
Synonyms: BMP12 | GDF-7
Compound class:
Endogenous peptide in human, mouse or rat
Comment: The active peptide is a disulphide bond-linked homodimer
Species: Human
|
Peptide Sequence | |
TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTL LNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR |
Post-translational Modification | |
The active peptide is a homodimer linked by a disulphide bond between cysteine residues at position 93 of each chain. Predicted disulphide bond formation between cysteine residues at positions 28 and 94, 57 and 126, and 61 and 128 |