Abbreviated name: GDF5
Synonyms: BMP-14 | bone morphogenetic protein 14 | cartilage-derived morphogenetic protein 1 (CDMP-1) | growth/differentiation factor 5 (GDF-5) | radotermin
Compound class:
Endogenous peptide in human, mouse or rat
Comment: The active peptide is a disulphide bond-linked homodimer
Species: Human
|
Peptide Sequence | |
APLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPEST PPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR |
Selected 3D Structures | ||
|
Post-translational Modification | |
The active peptide is a homodimer linked by a disulphide bond between cysteine residues at position 84 of each chain. Disulphide bond formation between cysteine residues at positions 19 and 85, 48 and 117, and 52 and 119 |