|
Synonyms: CTLA-8 | interleukin-17 alpha
Compound class:
Endogenous peptide in human, mouse or rat
Comment: Forms homodimeric ligand IL-17A, or heterodimeric IL-17A/IL-17F.
Species: Human
|
| Is a component of |
| IL-17A/IL-17F |
Peptide Sequence  |
|
|
GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINAD GNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA |
|
| Selected 3D Structures | ||
|
||
| Post-translational Modification | |
| Predicted N-linked glycosylation of aspragine residue at position 45; predicted disulphide bond formation between cysteine residues at positions 71 and 121, and 76 and 123 | |
