Compound class:
Endogenous peptide in human, mouse or rat
Comment: The B chain is 30 amino acids long, and relates to amino acids 25-54 of the pro-peptide sequence (P01308).
Species: Human
|
Is a component of |
insulin |
Peptide Sequence | |
FVNQHLCGSHLVEALYLVCGERGFFYTPKT | |
Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Thr |
Post-translational Modification | |
Two inter-chain disulphide bonds form with the insulin A chain to form the active peptide, between cysteine residues 7 of the B chain and 7 of the A chain, and 20 of the B chain and 19 of the A chain (numbering relative to the amino acid sequences of the individual peptide chains). |