T21/DP107

Ligand id: 6245

Name: T21/DP107

Peptide Sequence
NNLLRAIEAQQHLLQLTVWGIKQLQARILAVERYLKDQ
Ac-Asn-Asn-Leu-Leu-Arg-Ala-Ile-Glu-Ala-Gln-Gln-His-Leu-Leu-Gln-Leu-Thr-Val-Trp-Gly-Ile-Lys-Gln-Leu-Gln-Ala-Arg-Ile-Leu-Ala-Val-Glu-Arg-Tyr-Leu-Lys-Asp-Gln-NH2
Post-translational Modification
Acetylation of N-terminal asparagine residue; C-terminal residue is glutamine amide