BPTI-K15R/R17G   Click here for help

GtoPdb Ligand ID: 7897

Comment: This peptide is a mesotrypsin (PRSS3) inhibitor based upon the BPTI (bovine pancreatic trypsin inhibitor aka aprotinin) scaffold with P1 (Lys15 to Arg) and P2′ (Arg17 to Gly) modifications [1]. PRSS3 is an atypical isoform of trypsin. Its up-regulation may promote tumour progression. Hence, PRSS3 inhibitors are being investigated as anti-cancer agents.
Click here for help
Peptide Sequence Click here for help
RPDFCLEPPYTGPCRAGIIRYFYNAKAGLCQTFVYGGCRAKRNNFKSAEDCMRTCGGA