|
Abbreviated name: GDF15
Synonyms: macrophage inhibitory cytokine-1 | MIC-1 | MIC1 | PTGFB
Compound class:
Endogenous peptide in human, mouse or rat
Comment: GDF15 is a TGFβ family protein. A commentary on the function(s) of GDF15 was published in 2017 [6]. Experimental evidence indicates that the biological effects of GDF15 are mediated by signalling via a GFRAL/Ret complex [2,5-6,8].
GDF15 promotes nausea and vomiting (emesis), and elevated levels have been associated with pregnancy-induced morning sickness and the risk of hyperemesis gravidarum [3]. Disrupting the formation or function of the GDF15/GFRAL/Ret complex is a mechanism being explored for the mitigation of chemotherapy-induced nausea, cachexia and malaise [1,4,7].
Species: Human
Ligand Activity Visualisation ChartsThese are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts. ✖ |
Peptide Sequence  |
|
|
MPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDL VPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRPLRRQLSLARPQAPALHLRLS PPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMC IGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI |
|
| Post-translational Modification | |
|
Signal peptide: 1-29 Propeptide 30-194 Mature peptide chain 195-308 Three intrapeptide disulphide bonds, and one interpeptide (dimer forming) disulphide bond. |
|
