Ligand Id: 1517
Ligand name PYY-(3-36)
Species Human


Summary Biological activity References Structure Similar ligands Radio analogues
Peptide Sequence
IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY
Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
Search for 3D structures on the PDB
Search by keyword: PYY-(3-36) Search by accession number: P10082
Post-translational Modification
The C-terminal tyrosine is amidated.
Download 2D Structure
No information available.

Disclaimer: Peptide pages are currently under development, please exercise caution over the use of sequence and structural information provided here. Please send notification of errors to curators@iuphar-db.org.