[Ile5,Trp23,Tyr36]PTHrP-(1-36)-NH2 (human)

Ligand id: 1797

Name: [Ile5,Trp23,Tyr36]PTHrP-(1-36)-NH2 (human)

Peptide Sequence
AVSEIQLLHDKGKSIQDLRRRFWLHHLIAEIHTAEY
Ala-Val-Ser-Glu-Ile-Gln-Leu-Leu-His-Asp-Lys-Gly-Lys-Ser-Ile-Gln-Asp-Leu-Arg-Arg-Arg-Phe-Trp-Leu-His-His-Leu-Ile-Ala-Glu-Ile-His-Thr-Ala-Glu-Tyr-NH2
Chemical Modification
Histidine residue at position 5 is replaced by isoleucine; phenylalanine residue at position 23 is replaced by tryptophan; C-terminal isoleucine is replaced by tyrosine-amide