INSL3 (B chain)   Click here for help

GtoPdb Ligand ID: 3749

Synonyms: insulin-like peptide 3 B chain
Compound class: Endogenous peptide in human, mouse or rat
Species: Human
Is a component of
INSL3
Peptide Sequence Click here for help
PTPEMREKLCGHHFVRALVRVCGGPRWSTEA
Pro-Thr-Pro-Glu-Met-Arg-Glu-Lys-Leu-Cys-Gly-His-His-Phe-Val-Arg-Ala-Leu-Val-Arg-Val-Cys-Gly-Gly-Pro-Arg-Trp-Ser-Thr-Glu-Ala
Post-translational Modification
Fully active INSL3 is a heterodimer of the B chain and the A chain linked by two disulfide bonds, the first between B chain (residue 34) and A chain (residue 116), and the second between B chain (residue 46) and A chain (residue 129).