Ligand Id: 3981
Ligand name [3H]α-bungarotoxin


Summary Biological activity References Structure Similar ligands Radio analogues
Peptide Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Ile-Val-Cys-His-Thr-Thr-Ala-Thr-Ser-Pro-Ile-Ser-Ala-Val-Thr-Cys-Pro-Pro-Gly-Glu-Asn-Leu-Cys-Tyr-Arg-Lys-Met-Trp-Cys-Asp-Ala-Phe-Cys-Ser-Ser-Arg-Gly-Lys-Val-Val-Glu-Leu-Gly-Cys-Ala-Ala-Thr-Cys-Pro-Ser-Lys-Lys-Pro-Tyr-Glu-Glu-Val-Thr-Cys-Cys-Ser-Thr-Asp-Lys-Cys-Asn-Pro-His-Pro-Lys-Gln-Arg-Pro-Gly
Search for 3D structures on the PDB
Search by keyword: [3H]α-bungarotoxin
Post-translational Modification
Disulfide bridges between amino acids 3 - 23, 16 - 44, 29 - 33, 48 - 59, 60 - 65
Download 2D Structure
No information available.

Disclaimer: Peptide pages are currently under development, please exercise caution over the use of sequence and structural information provided here. Please send notification of errors to curators@iuphar-db.org.