thrombin heavy chain   Click here for help

GtoPdb Ligand ID: 4458

Synonyms: thrombin B chain (rat)
Species: Rat
Is a component of
Peptide Sequence Click here for help
IVEGWDAEKGIAPWQVMLFRKSPQELLCGASLISDRWVLTAAHCILYPPWDKNFTENDLLVRIGKHSRTRYERNVEKISM
LEKIYIHPRYNWRENLDRDIALLKLKKPVPFSDYIHPVCLPDKQTVTSLLQAGYKGRVTGWGNLRETWTTNINEIQPSVL
QVVNLPIVERPVCKASTRIRITDNMFCAGFKVNDTKRGDACEGDSGGPFVMKSPYNHRWYQMGIVSWGEGCDRNGKYGFY
THVFRLKRWMQKVIDQHR
Post-translational Modification
Active rat thrombin is a complex between thrombin light chain and thrombin heavy chain. The chains are linked by a disulphide bond between cysteine residues at position 8 of the light chain and 199 of the heavy chain.

Disulphide bodn formation in the heavy chain between cysteine residues at positions 28 and 44, 173 and 187, and 200 and 230