GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

growth/differentiation factor-7   Click here for help

GtoPdb Ligand ID: 4877

Abbreviated name: GDF7
Synonyms: BMP12 | GDF-7
Comment: The active peptide is a disulphide bond-linked homodimer
Species: Human
Peptide Sequence Click here for help
TALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKELGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTL
LNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR
Post-translational Modification
The active peptide is a homodimer linked by a disulphide bond between cysteine residues at position 93 of each chain. Predicted disulphide bond formation between cysteine residues at positions 28 and 94, 57 and 126, and 61 and 128