|
Abbreviated name: EFNA4
Synonyms: EPH-related receptor tyrosine kinase ligand 4 | LERK-4
Compound class:
Endogenous peptide in human, mouse or rat
Comment: From the ephrin A family of glycosylphosphatidylinositol-linked proteins
Species: Human
|
Peptide Sequence  |
|
|
LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGH VQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGES |
|
| Post-translational Modification | |
| Predicted disulphide bond formation between cysteine residues at positions 33 and 74, and 61 and 119. Predicted amidation of C-terminal serine residue; predicted N-linked glycosylation of asparagine residue at position 8 | |
