GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

ephrin-B3   Click here for help

GtoPdb Ligand ID: 4915

Abbreviated name: EFNB3
Synonyms: EPH-related receptor transmembrane ligand ELK-L3 | EPH-related receptor tyrosine kinase ligand 8
Comment: Ephrin B3 is a cell surface transmembrane ligand for Eph receptors (receptor tyrosine kinases, including EPHA4, EPHA3 and EPHB4). EFNB2 and EFNB3 are exploited for infection by the zoonotic henipaviruses, Nipah virus (NiV) and Hendra virus (HeV) [1-2]. These viruses emerged from bats during the 1990s and have since caused a number of deadly outbreaks in humans and domesticated animals. NiV and HeV infections in humans cause both neurological and respiratory symptoms. The WHO considers NiV as an emergong pathogen, with potential to cause infection of epidemic proportion. NiV has high mortality and morbidity rates and there is no effective anti-viral therapy.
Species: Human
Peptide Sequence Click here for help
LSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPNYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRP
DLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPME
RDRGAAHSLEPGKENLPGDPTSNATSRGAEGPLPPPSMPAVAGAAGGLALLLLGVAGAGGAMCWRRRRAKPSESRHPGPG
SFGRGGSLGLGGGGGMGPREAEPGELGIALRGGGAADPPFCPHYEKVSGDYGHPVYIVQDGPPQSPPNIYYKV
Post-translational Modification
Predicted disulphide bond formation between cysteine residues at positions 35 and 77, and 65 and 129. Predicted N-linked glycosylation of asparagine residue at position 183