GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

Fms-related tyrosine kinase 3 ligand   Click here for help

GtoPdb Ligand ID: 4932

Abbreviated name: FLT3L
Synonyms: Flt3 ligand | SL cytokine
Species: Human
Peptide Sequence Click here for help
TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIH
FVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPL
LLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEH
Selected 3D Structures
PDB Id: 1ete
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Predicted N-linked glycosylation of asparagine resdiues at positions 100 and 123; disulphide bond formation between cysteine resdiues at positions 4 and 85, 44 and 127, and 93 and 132