GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

hepatocyte growth factor beta chain   Click here for help

GtoPdb Ligand ID: 4951

Abbreviated name: HGF beta chain
Species: Human
Is a component of
Peptide Sequence Click here for help
VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGP
EGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNE
SEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS
Post-translational Modification
Predicted disulphide bond formation between cysteine residues at positions 25 and 41, 118 and 185, 148 and 164, and 175 and 203. Interchain disulphide bond between cysteine residue at position 456 of the alpha chain and 110 of the beta chain.