IFN-γ

Ligand id: 4968

Name: IFN-γ

Species: Human

IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: interferon-gamma (ifn-γ)

Peptide Sequence
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVK
FFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG
Selected 3D Structures
PDB Id: 1FG9
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Residue one is pyrrrolidine carboxylic acid; N linked glycosylation of asparagine residue at position 25; N-linked glycosylation of asparagine at position 97 in the dimeric form