IL-22

Ligand id: 4988

Name: IL-22

Species: Human

Peptide Sequence
APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQP
YMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Selected 3D Structures
PDB Id: 3DGC
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
N-linked glycosyaltion of asparagine residues at positions 21 and 64, and disulphide bond formation between cysteine residues at positions 7 and 99, and 56 and 145. Predicted N-linked glycosylation of asparagine residue at position 35