GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IL-22   Click here for help

GtoPdb Ligand ID: 4988

Synonyms: cytokine Zcyto18 | interleukin-22
Immunopharmacology Ligand
Comment: IL-22 is an IL-10 superfamily type II cytokine which plays a key role during inflammatory responses, and has potent neutrophil chemoattractant activity. It is regulated in part by IL-23. IL-22 has been demonstrated to play an important protective function in the gut where it promotes anti-microbial peptide expression. Via induction of intestinal epithelial stem cell proliferation, IL-22 is involved in gut barrier recovery after acute injury [2]. Conversely, IL-22 has also been implicated as a driving factor in chronic gut pathologies [5].
Species: Human
Click here for help
Peptide Sequence Click here for help
APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQP
YMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Selected 3D Structures
PDB Id: 3DGC
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
N-linked glycosyaltion of asparagine residues at positions 21 and 64, and disulphide bond formation between cysteine residues at positions 7 and 99, and 56 and 145. Predicted N-linked glycosylation of asparagine residue at position 35