|
Synonyms: cytokine Zcyto18 | interleukin-22
Compound class:
Endogenous peptide in human, mouse or rat
Comment: IL-22 is an IL-10 superfamily type II cytokine which plays a key role during inflammatory responses, and has potent neutrophil chemoattractant activity. It is regulated in part by IL-23. IL-22 has been demonstrated to play an important protective function in the gut where it promotes anti-microbial peptide expression. Via induction of intestinal epithelial stem cell proliferation, IL-22 is involved in gut barrier recovery after acute injury [2]. Conversely, IL-22 has also been implicated as a driving factor in chronic gut pathologies [5].
Species: Human
Ligand Activity Visualisation ChartsThese are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts. ✖ |
Peptide Sequence  |
|
|
APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQP YMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI |
|
| Selected 3D Structures | ||
|
||
| Post-translational Modification | |
| N-linked glycosyaltion of asparagine residues at positions 21 and 64, and disulphide bond formation between cysteine residues at positions 7 and 99, and 56 and 145. Predicted N-linked glycosylation of asparagine residue at position 35 | |
