|
Synonyms: IL-12 p35 | interleukin-12A | NKSF1
Compound class:
Endogenous peptide in human, mouse or rat
Comment: This is the alpha subunit of the active IL-12 hetreodimer.
Species: Human
|
| Is a component of |
| IL-12 |
Peptide Sequence  |
|
|
RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRET SFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSS LEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS |
|
| Post-translational Modification | |
| Predicted N-linked glycosylation of asparagine residues at positions 71 and 85; disulphide bond formation between cysteine residues at positions 42 and 174, and 63 and 101. In the heterodimer IL12A/IL12B an interchain disulphide bond is formed between cysteine residues at position 74 of the alpha chain and 177 of the beta chain | |
