|
Synonyms: beta-nerve growth factor | beta-NGF | Oxervate® | Sentinel®
NGF is an approved drug (EMA (2017), FDA (2018))
Compound class:
Endogenous peptide in human, mouse or rat
Comment: Recombinant NGF (cenegermin, also known as cenegermin-bkbj) is used clinically as a peripherally selective agonist of TrkA and LNGFR. Note that the recombinant peptide is two amino acids shorter than the endogenous peptide, with the carboxy-terminal RA (Arg-Ala) removed.
Species: Human
Ligand Activity Visualisation ChartsThese are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts. ✖ |
Peptide Sequence  |
|
|
SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYC TTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA |
|
| Post-translational Modification | |
| Disulphide bond formation between cysteine residues at positions 15 and 80, 58 and 108, and 68 and 110 | |
