neuregulin-1   Click here for help

GtoPdb Ligand ID: 5027

Abbreviated name: NRG-1
Synonyms: breast cancer cell differentiation factor p45 | glial growth factor (GGF) | heregulin | Neu differentiation factor (NDF)
Compound class: Endogenous peptide in human, mouse or rat
Species: Human
Peptide Sequence Click here for help
SGKKPESAAGSQSPALPPRLKEMKSQESAAGSKLVLRCETSSEYSSLRFKWFKNGNELNRKNKPQNIKIQKKPGKSELRI
NKASLADSGEYMCKVISKLGNDSASANITIVESNEIITGMPASTEGAYVSSESPIRISVSTEGANTSSSTSTSTTGTSHL
VKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTENVPMKVQNQEKAEELYQK
Selected 3D Structures
PDB Id: 1hae
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Predicted N-linked glycosylation of asparagine residues at positions 101, 107 and 145; predicted disulphide bond formation between cysteine resdiues at positions 38 and 93. Disulphide bond formation between cysteine residues at positions 163 and 177, 171 and 191, and 193 and 202