PDGFA   Click here for help

GtoPdb Ligand ID: 5042

Synonyms: PDGF subunit A | PDGF-1 | platelet-derived growth factor subunit A
Species: Human
Is a component of
Peptide Sequence Click here for help
SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKE
VQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT
Selected 3D Structures
PDB Id: 3MJK
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Predicted N-linked glycosylation of asparagine residue at position 128; disulphide bond formation between cysteine resdues at positions 10 and 54, 43 and 91, and 47 and 93. Interchain disulphide bonds when the alpha chain froms a homodimer with another alpha chain or a heterodimer with a beta chain- from cysteine residues at positions 37 and 46