PDGFB   Click here for help

GtoPdb Ligand ID: 5043

Synonyms: PDGF subunit B | PDGF-2 | platelet-derived growth factor B chain | platelet-derived growth factor subunit B
Species: Human
Is a component of
Peptide Sequence Click here for help
SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRK
KPIFKKATVTLEDHLACKCETVAAARPVT
Selected 3D Structures
PDB Id: 1pdg
Image of ligand 3D structure from RCSB PDB
Post-translational Modification
Disulphide bond formation between cysteine residues at positions 16 and 60, 49 and 97, and 53 and 99. Interchain disulphide bonds when the beta chain froms a homodimer with another beta chain or a heterodimer with an alpha chain- from cysteine residues at positions 43 and 52