|
Synonyms: Tumor necrosis factor ligand superfamily member 15, membrane form
Compound class:
Endogenous peptide in human, mouse or rat
Comment: TL1A occurs as both membrane‐bound and soluble forms. It principally functions as a negative modulator of epithelial cell proliferation. Inhibiting the TL1A/death receptor 3 (TNFRSF25) pathway has been proposed as mechanism to treat inflammatory bowel disease [1]. In addition, TL1A has been associated with tumourigenesis and progression of some gastrointestinal malignancies [3,5,7], making it a target of interest for the development of novel anti-cancer drugs.
Species: Human
|
Peptide Sequence  |
|
|
MAEDLGLSFGETASVEMLPEHGSCRPKARSSSARWALTCCLVLLPFLAGLTTYLLVSQLRAQGEACVQFQALKGQEFAPS HQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTS ECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTK EDKTFFGAFLL |
|
| Selected 3D Structures | ||
|
||
| Post-translational Modification | |
| Predicted N-linked glycosylation of asparagine residues at positions 133 and 229; disulphide bond formation between cysteine residues at positions 162 and 202 | |
