|
Abbreviated name: ANGPTL7
Synonyms: angiopoietin-like factor | angiopoietin-like protein 7 | AngX | CDT6 [1] | cornea-derived transcript 6 protein
Compound class:
Endogenous peptide in human, mouse or rat
Comment: An endogenous peptide, which is highly and specifically expressed in the cornea. Corneal expression is confined to the stromal layer [1]. It is highly homologous to the anti-angiogenic angiopoietins. and may contribute to the avascularity of the human cornea.
Species: Human
|
Peptide Sequence  |
|
|
QKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMN NQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYR DWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYH NNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP |
|
| Post-translational Modification | |
| Predicted N-linked glycosylation of asparagine residues at positions 58, 227, and 241. Predicted disulphide bond formation of cysteine residues at positions 105 and 136, and 259 and 272 | |
