GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.
Compound class:
Peptide
Comment: Synthetic analogue of FSH β subunit, one of the subunit components of the FSH synthetic analogue FSH deglycosylated α/β
|
Is a component of |
FSH deglycosylated α/β |
Peptide Sequence ![]() |
|
NSCELTQITIAIEKEECRFCISIQTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVAT QCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE |
Chemical Modification | |
Glycosylated asparagine residues at positions 7 and 24 of the natural sequence are replaced by glutamine residues |