GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

FSH β subunit-deglycosylated form   Click here for help

GtoPdb Ligand ID: 5537

Compound class: Peptide
Comment: Synthetic analogue of FSH β subunit, one of the subunit components of the FSH synthetic analogue FSH deglycosylated α/β
Is a component of
Peptide Sequence Click here for help
NSCELTQITIAIEKEECRFCISIQTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVAT
QCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Chemical Modification
Glycosylated asparagine residues at positions 7 and 24 of the natural sequence are replaced by glutamine residues