IL-33   Click here for help

GtoPdb Ligand ID: 5880

Synonyms: IL-1F11
Immunopharmacology Ligand
Compound class: Endogenous peptide in human, mouse or rat
Comment: IL-33 is a pleiotropic IL-1 family cytokine that can both promote type 2 inflammation and also drive immunoregulation through expansion of Foxp3+Treg cells. The outcomes of IL-33 activity appear to depend on the cells that produce it, either myeloid dendritic cells (DC) or epithelial cells [6]. DC-derived IL-33 supports Treg cells. The main cellular targets of IL-33 are innate lymphoid cells type 2 (ILC2), involved in the initiation of the type 2 immune response (secretion of IL-5 and IL-13) during parasitic infection and allergic diseases such as asthma. Full length IL-33 is cleaved by mast cell chymase (chymase 1; CMA1) to produce its significantly more active form [7].

The ST2/IL-33 axis is recognised as playing an important role in the development/exacerbation of IgE-dependent inflammations such as asthma and atopic dermatitis [1,5], and received much interest from the pharmaceutical industry. Blockade of IL-33 activity (and/or its receptor ST2) represent potential novel mechanisms for pharmaceutical intervention to suppress allergy and mast cell-eosinophil interplay. Indeed, astegolimab (RG6149/AMG 282) is an example of a fully human anti-IL-33 monoclonal antibody, that was developed as a potential therapy for mild atopic asthma and chronic rhinosinusitis. Unfortunalely, in common with other anti-IL-33 leads, RG6149 failed to deliver clinical efficacy in these indications.
Species: Human
Peptide Sequence Click here for help
SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKD
FWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET
Ser-Ile-Thr-Gly-Ile-Ser-Pro-Ile-Thr-Glu-Tyr-Leu-Ala-Ser-Leu-Ser-Thr-Tyr-Asn-Asp-Gln-Ser-Ile-Thr-Phe-Ala-Leu-Glu-Asp-Glu-Ser-Tyr-Glu-Ile-Tyr-Val-Glu-Asp-Leu-Lys-Lys-Asp-Glu-Lys-Lys-Asp-Lys-Val-Leu-Leu-Ser-Tyr-Tyr-Glu-Ser-Gln-His-Pro-Ser-Asn-Glu-Ser-Gly-Asp-Gly-Val-Asp-Gly-Lys-Met-Leu-Met-Val-Thr-Leu-Ser-Pro-Thr-Lys-Asp-Phe-Trp-Leu-His-Ala-Asn-Asn-Lys-Glu-His-Ser-Val-Glu-Leu-His-Lys-Cys-Glu-Lys-Pro-Leu-Pro-Asp-Gln-Ala-Phe-Phe-Val-Leu-His-Asn-Met-His-Ser-Asn-Cys-Val-Ser-Phe-Glu-Cys-Lys-Thr-Asp-Pro-Gly-Val-Phe-Ile-Gly-Val-Lys-Asp-Asn-His-Leu-Ala-Leu-Ile-Lys-Val-Asp-Ser-Ser-Glu-Asn-Leu-Cys-Thr-Glu-Asn-Ile-Leu-Phe-Lys-Leu-Ser-Glu-Thr