GtoPdb is requesting financial support from commercial users. Please see our sustainability page for more information.

IL-27 subunit β   Click here for help

GtoPdb Ligand ID: 6153

Synonyms: EBV-induced gene 3 protein | Epstein-Barr virus-induced gene 3 protein | IL-27 subunit beta | IL-27B | interleukin-27 subunit beta
Immunopharmacology Ligand
Comment: This is one of the subunits of biologically active IL-27.
Species: Human
Is a component of
Peptide Sequence Click here for help
RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMA
PYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRV
GPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
Post-translational Modification
Predicted N-linked glycosylation of asparagine residues at positions 35 and 85.