aflibercept

Ligand id: 6786

Name: aflibercept

Peptide Sequence
SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCE
ATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSG
SEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR
TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT
ISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS
RWQQGNVFSCSVMHEALHNH YTQKSLSLSPG
Post-translational Modification
This is a recombinant fusion protein comprising vascular endothelial growth factor (VEGF) binding portions from the extracellular domains of human VEGF receptors 1 and 2 fused to the Fc portion of human IgG1. It exists as a dimer, covalently linked by disulphide bridges.
Chemical Modification
Covalent disulphide bonds form between amino acids as follows:
Intra peptide disulphide bonds (30-79, 124-185, 246-306, 352-410)
Inter peptide disulphide bonds (214-214, 211-211)