adrenomedullin   Click here for help

GtoPdb Ligand ID: 683

Abbreviated name: AM
Immunopharmacology Ligand
Compound class: Endogenous peptide in human, mouse or rat
Comment: Adrenomedullin is 52 amino acid peptide which is mainly expressed in endothelial and smooth muscle cells. It acts as a vasodilatory peptide and it is known to regulate endothelial barrier function and vascular tone. Evidence from animal models indicates that it is a key player in the development of sepsis-associated hemodynamic and microcirculatory disorders.
Species: Human
Click here for help

Ligand Activity Visualisation Charts

These are box plot that provide a unique visualisation, summarising all the activity data for a ligand taken from ChEMBL and GtoPdb across multiple targets and species. Click on a plot to see the median, interquartile range, low and high data points. A value of zero indicates that no data are available. A separate chart is created for each target, and where possible the algorithm tries to merge ChEMBL and GtoPdb targets by matching them on name and UniProt accession, for each available species. However, please note that inconsistency in naming of targets may lead to data for the same target being reported across multiple charts.

✖

View interactive charts of activity data across species
Peptide Sequence Click here for help
YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY
Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2
Post-translational Modification
The cysteine residues at positions 16 and 21 form a disulphide bridge and the C-terminal tyrosine is amidated.