pegfilgrastim

Ligand id: 6969

Name: pegfilgrastim

Peptide Sequence
MAGPATQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLVSECATYKLCHPEEL
VLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMA
PALQPTQGAMPAFASAFQRR AGGVLVASHLQSFLEVSYRVLRHLAQP