calcitonin (salmon)

Ligand id: 6973

Name: calcitonin (salmon)

Abbreviated name: CT (salmon)

IUPHAR Pharmacology Education Project (PEP) logo

View more information in the IUPHAR Pharmacology Education Project: calcitonin salmon

Peptide Sequence
CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
Cys-Ser-Asn-Leu-Ser-Thr-Cys-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2